General Information

  • ID:  hor005976
  • Uniprot ID:  P33715
  • Protein name:  Urotensin-2
  • Gene name:  UTS2
  • Organism:  Pelophylax ridibundus (Marsh frog) (Rana ridibunda)
  • Family:  Urotensin-2 family
  • Source:  animal
  • Expression:  Central nervous system. Spinal cord.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pelophylax (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AGNLSECFWKYCV
  • Length:  13
  • Propeptide:  MSKLFFCCLILAGSFCSFRSLPIIVPSKGSLRLSESALDFGDLKSWDDETRLLRNLPMFVDKEAERDAEDIFSKEGFGLDAYNMDDKEELFDKHPRISLLSRLQSKDRKQFKKRAGNLSECFWKYCV
  • Signal peptide:  MSKLFFCCLILAGSFC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in smooth muscle stimulating and ion mobilizing activities. It has a suggested role as a corticotropin-releasing factor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-12
  • Structure ID:  AF-P33715-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005976_AF2.pdbhor005976_ESM.pdb

Physical Information

Mass: 173398 Formula: C69H98N16O19S2
Absent amino acids: DHIMPQRT Common amino acids: C
pI: 6.13 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 5
Hydrophobicity: 25.38 Boman Index: -296
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60
Instability Index: 4551.54 Extinction Coefficient cystines: 7115
Absorbance 280nm: 592.92

Literature

  • PubMed ID:  9861051
  • Title:  Cloning of the cDNA encoding the urotensin II precursor in frog and human reveals intense expression of the urotensin II gene in motoneurons of the spinal cord.
  • PubMed ID:  1445302
  • Title:  Isolation and primary structure of urotensin II from the brain of a tetrapod, the frog Rana ridibunda.